MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
PDK1 or PDPK1 is a 63kD monomeric protein which is also known as Akt kinase. PDK1 is composed of a C-terminal PH (pleckstrin homology) domain and an N-terminal catalytic domain. In response to insulin or insulin-like growth factor, PDK1 phosphorylates PKB/Akt1 on threonine 308 and serine 473 in a phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate-dependent manner. Phosphatidylinositol 3,4,5-triphosphate or phosphatidylinositol 3,4-biphosphate binds to the PH domains of PKB and PDK1 resulting in the translocation of these proteins to the cell membrane and activation of PKB. PDK1 also phosphorylates the 70kD ribosomal protein S6 kinase at threonine 229, which is required for its activation. Thus, PDK1 acts upstream of PKB and has been shown to control signals for proliferation and apoptosis.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
ILKMGPVDKRKGLFARRRQLLLTEGPHLYYVDPVNKVLKGEIPWSQELRPEAKNFKTFFVHTPNRTYYLMDPSGNAHKWCRKIQEVWRQRYQSHPDAAVQ
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa457-557 from human PDPK1 (NP_002604) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PDPK1. Species Crossreactivity: rat.