MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
PDX1, also known as Pancreas/duodenum homeobox protein 1, is a nuclear protein belonging to the Antp homeobox family and IPF1/XlHbox-8 subfamily with a homeobox DNA-binding domain. It activates insulin, somatostatin, glucokinase, islet amyloid polypeptide and glucose transporter type 2 gene transcription and is particularly involved in glucose-dependent regulation of insulin gene transcription. During development, PDX1 specifies the early pancreatic epithelium, permitting its proliferation, branching and subsequent differentiation. Expression is common in duodenum and pancreas (Langerhans islet beta cells and small subsets of endocrine non-beta-cells, at low levels in acinar cells). Defects in PDX1 are associated with pancreatic agenesis, maturity onset diabetes noninsulin-dependent diabetes mellitus (NIDDM), also known as diabetes mellitus type II, and maturity onset diabetes of the young type 4 (MODY4).
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
LEEPNRVQLPFPWMKSTKAHAWKGQWAGGAYAAEPEENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKEEDKK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Recombinant corresponding to aa109-208 from human IPF1 (NP_000200) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human IPF1.