PIK3AP1 is involved in the activation of phosphoinositide 3-kinase (PI3K) in B-cells and in natural killer (NK) cells. Couples B-cell antigen receptor (BCR) to PI3K activation by providing a docking site for the PI3K subunit PIK3R1, which contributes to B-cell development. Seems to have a complementary role with CD19 in PI3K activation (By similarity). May be involved in the survival of mature B cells via activation of REL (By similarity).

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

KTPGQRQLITLQEQVKLGIVNVDEAVLHFKEWQLNQKKRSESFRFQQENLKRLRDSITRRQREKQKSGKQTDLEITVPIRHSQHLPAKVEFGVYESGPRK

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa601-701 from human PIK3AP1 (NP_689522) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human PIK3AP1.