Phosphatidylinositol-specific phospholipase C (PLC) plays an important role in receptor-mediated signal transduction by generating 2 second messenger molecules, inositol 1,4,5-triphosphate (IP3) and diacylglycerol, from phosphatidylinositol 4,5-bisphosphate (PIP2). PLC comprises a diverse family of enzymes that differ in structure and tissue distribution (Berridge, 1993 [PubMed 8381210]).

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MQEGMPMRKVRSKSWKKLRYFRLQNDGMTVWHARQARGSAKPSFSISDVETIRNGHDSELLRSLAEELPLEQGFTIVFHGRRSNLDLMANSVEEAQIWMRGLQLLVDLVT

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa18-128 from human PLCD4 (AAH06355) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human PLCD4.