PPAR (Peroxisome proliferator-activated receptor) is a member of the nuclear hormone receptor superfamily and functions as a transcriptional activator. PPARa is preferentially expressed in liver, skeletal muscle, heart and kidney. PPARa is involved in regulation of lipid homeostasis. Its ligands include fatty acids, NSAIDs, prostaglandins, leukotriene B4, etc. PPARa transcriptionally regulates a variety of genes for enzymes and proteins involved in fatty acid metabolism and oxidation.
Applications
Suitable for use in Immunofluorescence and ELISA. Other applications not tested.
Recommended Dilution
Immunofluorescence: 10ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
MVDTESPLCPLSPLEAGDLESPLSEEFLQEMGNIQEISQSIGEDSSGSFGFTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNIECRICGDKASGYHYGVHACEGCKGFFRRTIRLKLVYDKCDRSCKIQKKNRNKCQYCRFHKCLSVGRSHNAIRFGRMPRSEKAKLKAEILTCEHDIEDSETADLKSLAKRIYEAYLKNFNMNKVKARVILSGKASNNPVGVCGCSGFSWQHGTSVVEDD
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Full length recombinant corresponding to aa1-259 from human PPARA (AAH00052) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human PPARA.