Roundabout Homolog 1 (ROBO1) is a type I transmembrane protein belonging to the ROBO family, which defines a novel subfamily of immunoglobulin superfamily proteins. ROBO family proteins are evolutionarily conserved receptors that interact with the secreted Slit proteins. ROBO-Slit interactions play an important role in axon guidance across the midline during central nervous system development. ROBO signaling also has a role in tumor angiogenesis and immune responses.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

DGVLVSTQDSRIKQLENGVLQIRYAKLGDTGRYTCIASTPSGEATWSAYIEVQEFGVPVQPPRPTDPNLIPSAPSKPEVTDVSRNTVTLSWQPNLNSGA

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa491-590, from human ROBO1 (NP_002932) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human ROBO1.