MSK1 is a dual kinase domain protein that acts downstream of the ERK1/2 and p38 MAPK signalling pathways. MSK1 phosphorylate the transcription factors CREB and ATF1, and the chromatin proteins histone H3 and HMGN1 in response to either mitogenic stimulation or cellular stress. MSK1 activity is tightly regulated in cells, and activation requires its phosphorylation by either ERK1/2 or p38alpha. This result in activation of the C-terminal kinase domain, which then phosphorylates further sites in MSK1, leading to the activation of the N-terminal kinase domain and phosphorylation of substrates. The protein contains two complete nonidentical protein kinase domains. The protein is widely expressed in human brain, heart, and placenta. Human MSK1 gene is mapped to chromosomal region 14q31-q32.1.

Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.

RIGNGKFSLSGGNWDNISDGAKDLLSHMLHMDPHQRYTAEQILKHSWITHRDQLPNDQPKRNDVSHVVKGAMVATYSALTHKTFQPVLEPVAASSLAQRRSMKKRTSTGL*

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Partial recombinant corresponding to aa636-746 from human RPS6KA6 with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human RPS6KA6. Species Crossreactivity: rat.