Implicated in synaptic vesicle endocytosis. May recruit other proteins to membranes with high curvature.
Applications
Suitable for use in ELISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (FFPE): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
SRAKLSMINTMSKIRGQEKGPGYPQAEALLAEAMLKFGRELGDDCNFGPALGEVGEAMREL
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Partial recombinant protein corresponding to aa64-124 from human SH3GL2 (NM_003026, NP_003017) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.4.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human SH3GL2. Species Crossreactivity: rat