MaxLight™550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor™546, 555, DyLight™549 , Cy3™, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
SHIP2 (inositol polyphosphate-5 phosphatase-like 1), contains a phosphatase domain and an SH2 (src-homology domain 2) motif. SHIP2 iswidely expressed in fibroblast and nonhematopoietic tumor cell lines. Tyrosine phosphorylation of SHIP2 occurrs in response to treatment of cells with EGF, platelet-derived growth factor (PDGF), nerve growth factor (NGF), insulin-like growth factor-1 (IGF1), or insulin. EGF and PDGF induces transient tyrosine phosphorylation of SHIP2, while treatment of cells with NGF, IGF1, or insulin results in prolonged tyrosine phosphorylation of SHIP2, indicaating that SHIP2 may play a significant role in regulation of phosphatidylinositol 3-prime-kinase signaling by growth factors and insulin. Some animal models indicate that SHIP2 is a potent negative regulator of insulin signaling and insulin sensitivity in vivo, while others suggest that SHIP2 mediates obesity resistance but not changes in glucose and insulin homeostasis.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
PSDYGRPLSFPPPRIRESIQEDLAEEAPCLQGGRASGLGEAGMSAWLRAIGLERYEEGLVHNGWDDLEFLSDITEEDLEEAGVQDPAHKRLLLDTLQLSK
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1159-1258 from human INPPL1 (NP_001558) with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.
Purity
Purified by Protein A affinity chromatography.
Specificity
Recognizes human INPPL1.