SLAP also known as Src-like-adapter protein 1 is a 276aa containing adapter protein, functioning as a negative regulator of T-cell receptor (TCR) signaling. SLAP belonging to the SRC family of cytoplasmic tyrosine kinases contains a SH2 domain and a SH3 domain. This cytoplasmic protein colocalizes with endosomes and is known to inhibit T-cell antigen-receptor induced activation of nuclear factor of activated T-cells. It acts as a negative regulator of positive selection and mitosis of T-cells. SLAP may act by linking signaling proteins such as ZAP70 with CBL, leading to a CBL dependent degradation of signaling proteins. Expression of SLAP is weak in heart, adult brain, placenta, liver, skeletal muscle, kidney and pancreas but is high in lung and fetal brain.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MGNSMKSTPAPAERPLPNPEGLDSDFLAVLSDYPSPDISPPIFRRGEKLRVISDEGGWWKAISLSTGRESYIPGICVARVYHGWLFEGLGRDKAEELLQLPDTKVGSFMIRESETKKGFYSLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQSTAAPAVRASSSPVTLRQKTVDWRRVSRLQEDPEGTENPLGVDESLFSYGLRESIASYLSLTSEDNTSFDRKKKSISLMYGGSKRKSSFFSSPPYFED

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length recombinant corresponding to aa1-277 from human SLA (AAH07042) with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human SLA.