TSC22 domain family protein, or TSC22, is a transcription factor that belongs to the large family of early response genes. This transcriptional repressor is known to act on the C-type natriuretic peptide (CNP) promoter. TSC22 belongs to the TSC-22:Dip:Bun family and is an intracellular protein that may be found in the cytoplasm or nucleus. This transcription factor is known to regulate cell growth, differentiation and cell death and is involved in modulating the transcriptional activity of Smad3 and Smad4. This protein is ubiquitously expressed in most tissues and widely in both fetal and adult tissues. It is generally expressed in aortic endothelial cells, and induced by cytokines, including TGFB. These proteins may be possible therapeutic targets of leukemia and prostate cancer.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Full length human TSC22D1, aa1-144 (NP_006013.1).

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes human TSC22D1.