CDH3 is a classical cadherin from the cadherin superfamily. The protein is a calcium-dependent cell-cell adhesion glycoprotein comprised of five extracellular cadherin repeats, a transmembrane region and a highly conserved cytoplasmic tail. Its gene is located in a six-cadherin cluster in a region on the long arm of chromosome 16 that is involved in loss of heterozygosity events in breast and prostate cancer. In addition, aberrant expression of this protein is observed in cervical adenocarcinomas. Mutations in its gene have been associated with congential hypotrichosis with juvenile macular dystrophy.

Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.

Western Blot: 1.25ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Synthetic peptide corresponding to AVSENGASVEDPMNISIIVTDQNDHKPKFTQDTFRGSVLEGVLPGTSVMQ

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified by Protein A affinity chromatography.

Recognizes CDH3. Species Crossreactivity: Human and mouse.