ELOVL7 could be implicated in synthesis of very long chain fatty acids and sphingolipids.

Suitable for use in Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Synthetic peptide corresponding to the region MAFSDLTSRTVHLYDNWIKDADPRVEDWLLMSSPLPQTILLGFYVYFVTS from human ELOVL7 at N-terminal. Species Sequence Homology: mouse, rat, bovine, canine, guinea pig, equine and rabbit

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™550.

Purified by Protein A affinity chromatography.

Recognizes human ELOVL7.