Suitable for use in Western Blot and Immunohistochemistry. Other applications not tested.

Western Blot: 2.5ug/ml Immunohistochemistry: 4-8ug/ml Optimal dilutions to be determined by the researcher.

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

Synthetic peptide corresponding to MSLLCRNKGCGQHFDPNTNLPDSCCHHPGVPIFHDALKGWSCCRKRTVDF

Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).

Purified by Protein A affinity chromatography.

Recognizes ITGB1BP2. Species Crossreactivity: Human, mouse and rat.