Suitable for use in Western Blot. Other applications not tested.

Western Blot: 1.25ug/ml Optimal dilutions to be determined by the researcher.

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

C-terminus of SLC35B1 corresponding to ALGQSFIFMTVVYFGPLTCSIITTTRKFFTILASVILFANPISPMQWVGT

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

Purified by Protein A affinity chromatography.

Recognizes SLC35B1. Species Crossreactivity: Human, mouse, rat and canine.