This gene, CCL15, is one of several CC cytokine genes clustered on 17q11.2. The CC cytokines are secreted proteins characterized by two adjacent cysteines. The cytokine encoded by this gene is chemotactic for T cells and monocytes and induces N-acetyl-beta-D-glucosaminidase release in monocytes. It induces changes in intracellular calcium concentration in monocytes and is thought to act through the CCR1 receptor. Read-through transcripts are expressed that include exons from the downstream cytokine gene CCL14, and are represented as GeneID: 348249. [provided by RefSeq

Suitable for use in FLISA. Other applications not tested.

Optimal dilutions to be determined by the researcher.

NDAETELMMSKLPLENPVVLNSFHFAADCCTSYISQSIPCSLMKSYFETSSECSKPGVIFLTKKGRQVCAKPSGPGVQDCMKKLKPYSI

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

CCL15 (NP_116741, 25aa-113aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.

Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight™650.

Purified

Recognizes CCL15.