Interleukin 17B, IL-17B, IL-20, MGC138900, MGC138901, ZCYTO7
The protein encoded by this gene is a T cell-derived cytokine that shares sequence similarity with IL17. This cytokine was reported to stimulate the release of TNF alpha (TNF) and IL1 beta (IL1B) from a monocytic cell line. Immunohistochemical analysis of several nerve tissues indicated that this cytokine is primarily localized to neuronal cell bodies. [provided by RefSeq
Applications
Suitable for use in FLISA, Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
RSPKSKRKGQGRPGPLAPGPHQVPLDLVSRMKPYARMEEYERNIEEMVAQLRNSSELAQRKCEVNLQLWMSNKRSLSPWGYSINHDPSRIPVDLPEARCL
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Immunogen
IL17B (NP_055258, 23aa-122aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Form
Supplied as a liquid in PBS, pH 7.2. Labeled with Allophycocyanin (APC).
Specificity
Recognizes IL17B.
TDS
NCBI
UniProt
Tech Support
Customer Service
