ITGBL1, Osteoblast-specific cysteine-rich protein, Ten integrin EGF-like repeat domain-containing protein, OSCP, TIED
This gene encodes a beta integrin-related protein that is a member of the EGF-like protein family. The encoded protein contains integrin-like cysteine-rich repeats. Alternative splicing results in multiple transcript variants.
Applications
Suitable for use in Western Blot. Other applications not tested.
Recommended Dilution
Western Blot: 1:500-1:2000 Optimal dilutions to be determined by the researcher.
AA Sequence
CYCGNCYCKAGWHGDKCEFQCDITPWESKRRCTSPDGKICSNRGTCVCGECTCHDVDPTGDWGDIHGDTCECDERDCRAVYDRYSDDFCSGHGQCNCGRCD
Positive Control
NIH/3T3, mouse spleen, rat spleen
Storage and Stability
May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 12 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunogen
Synthetic peptide corresponding to a sequence within aa200-300 of human ITGBL1.
Form
Supplied as a liquid in PBS, pH 7.3, 0.02% sodium azide, 50% glycerol.
Purity
Purified by affinity chromatography.
Specificity
Recognizes human ITGBL1. Species Crossreactivity: mouse