USBio Logo

584866 Anti-HLA Class I Histocompatibility Antigen, Alpha Chain G, Recombinant, Human, aa25-338, His-SUMOSTAR-Tag

Specifications
Swiss Prot
P17693
Grade
Purified
Shipping Temp
Blue Ice
Storage Temp
-20°C
B2 microglobulin; DADB-15K14.8; HLA 6.0; HLA class I histocompatibility antigen alpha chain G; HLA class I histocompatibility antigen; alpha chain G; HLA class I molecule; HLA G; HLA G antigen; HLA G histocompatibility antigen class I G; HLA G3; HLA-G; HLA-G histocompatibility antigen; class I; HLA60; HLAG; HLAG_HUMAN; Major histocompatibility complex class I G; MHC class I antigen; MHC class I antigen G; MHC G; T-cell A locus; TCA

Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface. In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins. Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance. Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling. Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. May play a role in balancing tolerance and antiviral-immunity at maternal-fetal interface by keeping in check the effector functions of NK, CD8+ T cells and B cells. Reprograms B cells toward an immune suppressive phenotype via LILRB1. May induce immune activation/suppression via intercellular membrane transfer (trogocytosis), likely enabling interaction with KIR2DL4, which resides mostly in endosomes. Through interaction with the inhibitory receptor CD160 on endothelial cells may control angiogenesis in immune privileged sites.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Likely does not bind B2M and presents peptides. Negatively regulates NK cell- and CD8+ T cell-mediated cytotoxicity.; Non-classical major histocompatibility class Ib molecule involved in immune regulatory processes at the maternal-fetal interface. In complex with B2M/beta-2 microglobulin binds a limited repertoire of nonamer self-peptides derived from intracellular proteins including histones and ribosomal proteins. Peptide-bound HLA-G-B2M complex acts as a ligand for inhibitory/activating KIR2DL4, LILRB1 and LILRB2 receptors on uterine immune cells to promote fetal development while maintaining maternal-fetal tolerance. Upon interaction with KIR2DL4 and LILRB1 receptors on decidual NK cells, it triggers NK cell senescence-associated secretory phenotype as a molecular switch to promote vascular remodeling and fetal growth in early pregnancy. Through interaction with KIR2DL4 receptor on decidual macrophages induces proinflammatory cytokine production mainly associated with tissue remodeling. Through interaction with LILRB2 receptor triggers differentiation of type 1 regulatory T cells and myeloid-derived suppressor cells, both of which actively maintain maternal-fetal tolerance. Reprograms B cells toward an immune suppressive phenotype via LILRB1.; Likely does not bind B2M and presents peptides.; Likely does not bind B2M and presents peptides.

Source
Recombinant protein corresponding to aa25-338 from human HLA class I histocompatibility antigen, alpha chain G, fused to 6X His-SUMOSTAR-Tag at N-terminal, expressed in Yeast.
Molecular Weight
~48.7kD
Amino Acid Sequence
GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Source
Recombinant, Yeast
Purity
≥85% (SDS-PAGE)
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Purity
≥85% (SDS-PAGE)
Conjugates
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
Contact Us

Visit our technical library or contact our support staff to answer your questions.

Telephone:
1-800-520-3011

Library | Contact

Distributors

For customers outside of the United States, please use one of our many distributors.

View Distributors

Payment Methods

We accept the following payment methods as well as pay-by-invoice.

MasterCard Visa PayPal
© 2023-2024 United States Biological - All Rights Reserved