DHX9 CAS

Grade

Affinity Purified

Accession Number

NM_001357, NP_001348

EU Commodity Code

30021010

Shipping Temp

Blue Ice

Storage Temp

4°C Do Not Freeze

Notes

BSA Free

DHX9, otherwise known as ATP-dependent RNA helicase A, is a transcriptional activator and member of the DEAD box helicase family. DHX9 is a component of the coding region determinant (CRD)-mediated complex and exhibits RNA helicase activity, unwinding double-stranded DNA and RNA in a 3' to 5' direction.

Applications

Suitable for use in Immunofluorescence, FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Recommended Dilution

Immunofluorescence: 10ug/ml FLISA: The detection limit is ~3ng/ml as a capture antibody Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml stains DHX9 on human testis Optimal dilutions to be determined by the researcher.

Amino Acid Sequence

MGDVKNFLYAWCGKRKMTPSYEIRAVGNKNRQKFMCEVQVEGYNYTGMGNSTNKKDAQSNAARDFVNYLVRINEIKSEEVPAFGVASPPP

Storage and Stability

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.

References

1. Coordinate roles of Gag and RNA helicase A in promoting the annealing of tRNALys3 to HIV-1 RNA. Xing L, Liang C, Kleiman L.J Virol. 2010 Nov 24. [Epub ahead of print]. 2.Functional proteomic analysis of promyelocytic leukaemia nuclear bodies in irradiation-induced MCF-7 cells. Liu J, Song Y, Tian B, Qian J, Dong Y, Liu J, Liu B, Sun Z.J Biochem. 2010 Dec;148(6):659-67. Epub 2010 Sep 7. 3. RNA Helicase A Interacts with RISC in Human Cells and Functions in RISC Loading. Robb GB, Rana TM.Mol Cell. 2007 May 25;26(4):523-37.

USBio References

No references available

Product	Size	List	Your Price	Qty	Ext Price
Subtotal:	Subtotal:
Subtotal:	Subtotal:
Total Coupon Savings:	Total Coupon Savings:	()
Your cart is currently empty.
- Coupon Code

Product

Size

List

Your Price

Qty

Ext Price

Subtotal:

Total Coupon Savings:

()

Your cart is currently empty.

- Coupon Code

125839-APC DHX9 (DEAH (Asp-Glu-Ala-His) Box Polypeptide 9, DEAH Box Protein 9, DHX-9, DEAD/H (Asp-Glu-Ala-Asp/His) Box Polypeptide 9, DDX9, DDX-9, ATP-dependent RNA Helicase A, LKP, Nuclear DNA Helicase II, NDHII, NDH2, RNA Helicase A, RHA) (APC) CAS:

Grade

Accession Number

EU Commodity Code

Shipping Temp

Storage Temp

Notes

References

USBio References

Pricing

Order

Cart Summary

Recently Viewed

Special Offers

Contact Us

Site Map

Technical Resources

Distributors

Payment Methods