DIO1 CAS

Subscribe to our newsletter!

Welcome | LOG OUT

125850 DIO1 (Type I Iodothyronine Deiodinase, Type-I 5'-deiodinase, Type 1 DI, DIOI, 5DI, TXDI1, ITDI1) CAS:

Specifications

Grade

Affinity Purified

Accession Number

NM_000792, NP_000783.2

EU Commodity Code

30021010

Shipping Temp

Blue Ice

Storage Temp

-20°C

DIO1 is a thiol-requiring propylthiouracil-sensitive oxidoreductase. It activates thyroid hormone by converting the prohormone thyroxine (T4) by outer ring deiodination (ORD) to bioactive 3,3',5-triiodothyronine (T3). It also degrades both hormones by inner ring deiodination (IRD).

Applications

Suitable for use in ELISA. Other applications not tested.

Recommended Dilution

Optimal dilutions to be determined by the researcher.

AA Sequence

DRVKRNILAMGEKTGMTRNPHFSHDNWIPTFFSTQYFWFVLKVRWQRLEDTTELGGLAPNCPVVRLSGQRCNIWEFMQGNRPLVLNFGSCT

Storage and Stability

May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.