USBio Logo

126934-ML650 FOXA1 (Forkhead Box A1, Hepatocyte Nuclear Factor 3 alpha, HNF-3-alpha, HNF3A, HNF-3A, MGC33105, Transcription Factor 3A, TCF3A, TCF-3A) (MaxLight 650) CAS:

Specifications
References
Brand
MaxLight™
Grade
Affinity Purified
Accession Number
NM_004496, NP_004487
EU Commodity Code
30021010
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze
Notes
Preservative Free

MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.

FOXA1 (HNF3A, Hepatocyte nuclear factor 3- alpha) is member of the Forkhead family of winged-helix transcription factors. It is known to be involved in the development and differentiation of several organs including liver, kidney, pancreas, lung, prostate and mammary gland (Lupien, 2008). High expression of FOXA1 is often seen in tumors arising from both the prostate and breast where it is believed to interact with either the androgen receptor or estrogen receptor alpha, in each of the tumor type respectively (Lupien, 2008). In the case of ERa, FOXA1 has gained notice because of its interactions with the cis- regulatory regions in heterochromatin and because it enhances the interaction of ERa with chromatin (Badve, 2007).
Applications
Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.
Recommended Dilution
Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.
AA Sequence
LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
References
1. Association of GATA3, P53, Ki67 status and vascular peritumoral invasion are strongly prognostic in luminal breast cancer. Jacquemier J, Charafe-Jauffret E, Monville F, Esterni B, Extra JM, Houvenaeghel G, Xerri L, Bertucci F, Birnbaum D.Breast Cancer Res. 2009;11(2):R23. Epub 2009 Apr 30. 2. Estrogen induces repression of the breast cancer and salivary gland expression gene in an estrogen receptor alpha-dependent manner. Bretschneider N, Brand H, Miller N, Lowery AJ, Kerin MJ, Gannon F, Denger S.Cancer Res. 2008 Jan 1;68(1):106-14.
USBio References
No references available
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved