USBio Logo

126940-ML650 FOXC1 (Forkhead Box Protein C1, Forkhead-related Protein FKHL7, Forkhead-related Transcription Factor 3, FREAC-3, FKHL7, FREAC3) (MaxLight 650) CAS:

Specifications
Brand
MaxLight™
Grade
Affinity Purified
Accession Number
NM_001453, NP_001444
EU Commodity Code
30021010
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze
Notes
Preservative Free

MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.

FOXC1, otherwise known as Forkhead box C1, a member of the Forkhead family of transcription factors, shown to be involved in the development of the eye. Studies have shown that FOXC1 plays an important role in the regulation of the FGF19-FGFR4-MAPK pathway involved in the maintenance of anterior segment structures within the eye. Studies have also shown that FOXC1 is essential for the aggressive phenotype of basal-like triple-negative breast cancer (TNBC), for which FOXC1 may prove to be a valuable diagnostic marker. Mutations in the FOXC1 gene are responsible for various ocular abnormalities including Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis anomaly (IGDA), and Peters anomaly.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF*
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved