USBio Logo

123144-ML650 AKAP9 (A-kinase Anchor Protein 9, AKAP-9, A-kinase Anchor Protein 350kD, AKAP 350, hgAKAP 350, A-kinase Anchor Protein 450kD, AKAP 450, CG-NAP, Protein Hyperion, Protein Kinase A-anchoring Protein 9, AKAP 120-like Protein, Centrosome- and Golgi-localized PKN-associated Protein, PRKA9, Protein Yotiao, AKAP350, AKAP450, KIAA0803) (MaxLight 650)

Specifications
Brand
MaxLight™
Conjugate
MaxLight™650
Specificity
Recognizes human AKAP9.
Source Antibody
human
Purity
Purified by Protein A affinity chromatography.
Accession Number
NM_147171, NP_671700
EU Commodity Code
30021010
Shipping Temp
Blue Ice
Storage Temp
4°C Do Not Freeze
Notes
Preservative Free

MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.

The A-kinase anchor proteins (AKAPs) are a group of structurally diverse proteins which have the common function of binding to the regulatory subunit of protein kinase A (PKA) and confining the holoenzyme to discrete locations within the cell. This gene encodes a member of the AKAP family. Alternate splicing of this gene results in many isoforms that localize to the centrosome and the Golgi apparatus, and interact with numerous signaling proteins from multiple signal transduction pathways. These signaling proteins include type II protein kinase A, serine/threonine kinase protein kinase N, protein phosphatase 1, protein phosphatase 2a, protein kinase C-epsilon and phosphodiesterase 4D3.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
EKTDSFYHSSGGLELYGEPRHTTYRSRSDLDYIRSPLPFQNRYPGTPADFNPGSLACSQLQNYDPDRALTDYITRLEALQRRLGTIQSGSTTQFHAGMRR
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.
Pricing
Order
Proceed to Checkout
Cart Summary
ProductSizeListYour PriceQtyExt Price
Subtotal:Subtotal:
Subtotal:Subtotal:
Total Coupon Savings:Total Coupon Savings:()
Your cart is currently empty.
- Coupon Code
Recently Viewed
  • Contact Us

    Visit our technical library or contact our support staff to answer your questions.

    Telephone:
    1-800-520-3011

    Library | Contact

    Distributors

    For customers outside of the United States, please use one of our many distributors.

    View Distributors

    Payment Methods

    We accept the following payment methods as well as pay-by-invoice.

    MasterCard Visa PayPal
    © 2023-2024 United States Biological - All Rights Reserved