FOXA1 (HNF3A, Hepatocyte nuclear factor 3- alpha) is member of the Forkhead family of winged-helix transcription factors. It is known to be involved in the development and differentiation of several organs including liver, kidney, pancreas, lung, prostate and mammary gland (Lupien, 2008). High expression of FOXA1 is often seen in tumors arising from both the prostate and breast where it is believed to interact with either the androgen receptor or estrogen receptor alpha, in each of the tumor type respectively (Lupien, 2008). In the case of ERa, FOXA1 has gained notice because of its interactions with the cis- regulatory regions in heterochromatin and because it enhances the interaction of ERa with chromatin (Badve, 2007).

Suitable for use in FLISA, Western Blot and Immunohistochemistry. Other applications not tested.

Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml Optimal dilutions to be determined by the researcher.

LASVPASHPAHGLAPHESQLHLKGDPHYSFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPYGSTLPASLPLGSASVTTRSPIEPSALEPAYYQGVYSRPVLNTS

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.