FOXC1, otherwise known as Forkhead box C1, a member of the Forkhead family of transcription factors, shown to be involved in the development of the eye. Studies have shown that FOXC1 plays an important role in the regulation of the FGF19-FGFR4-MAPK pathway involved in the maintenance of anterior segment structures within the eye. Studies have also shown that FOXC1 is essential for the aggressive phenotype of basal-like triple-negative breast cancer (TNBC), for which FOXC1 may prove to be a valuable diagnostic marker. Mutations in the FOXC1 gene are responsible for various ocular abnormalities including Axenfeld-Rieger syndrome (ARS), iridogoniodysgenesis anomaly (IGDA), and Peters anomaly.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

AAHQGRLTSWYLNQAGGDLGHLASAAAAAAAAGYPGQQQNFHSVREFESQRIGLNNSPVNGNSSCQMAFPSSQSLYRTSGAFVYDCSKF*

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.