FOXP1, an 85kD member of the winged helix/forkhead transcription factor family. The FOXP1 transcription factor is widely expressed in human tissues and is predominantly localised to the nucleus. However, the level of expression does vary between cells and between different tissues. The expression of FOXP1 is reported to be abnormal in a range of solid tumors. Studies suggest that FOXP1 functions as a transcriptional repressor.

Suitable for use in FLISA and Western Blot. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MMQESGTETKSNGSAIQNGSGGSNHLLECGGLREGRSNGETPAVDIGAADLAHAQQQQQQWHLINHQPSRSPSSWLKRLISSPWELEVLQVPLWGAVAETKMSGPVCQPNPSPF*

Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Note: Applications are based on unconjugated antibody.