~48kD

57pmol/min/ug

IDH reductive activity was measured in 200ul reaction containing 25mM Tris (pH 7.4), 150 mM sodium chloride, 10mM MgCl2, 0.03% BSA, 1mM alpha-Ketoglutarate, 10uM NADPH and IDH. Depletion of NADPH was monitored continuously at 340nm for 20 minutes. Molar extinction coefficient of NADPH is 6,200 M-1cm-1

Useful for the study of enzyme kinetics, screening inhibitors, and selectivity profiling. Other applications not tested.

Optimal dilutions to be determined by the researcher.

MSKKISGGSVVEMQGDEMTRIIWELIKEKLIFPYVELDLHSYDLGIENRDA TNDQVTKDA AEAIKKHNVGVKCATITPDEKRVEEFKLKQMWKSPNGTIRNILGGTVFREAIICKNIPRLV SGWVKPIIIGHHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVA MGMYNQDKSIEDFAHSSFQMALSKGWPLYLSTKNTILKKYDGRFKDIFQEIYDKQYKSQ FEAQKIWYEHRLIDDMVAQAMKSEGGFIWACKNYDGDVQSDSVAQGYGSLGMMTSVLVCPDGKTVEAEAAHGTVTRHYRMYQKGQETSTNPIASIFAWTRGLAHRAKLDNNKELAFFANALEEVSIETIEAGFMTKDLAACIKGLPNVQRSDYLNTFEFMDKLGENLKIKLAQAKL DYKDDDDK

Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Sf9 cells

~90%

Supplied as a liquid in 40mM Tris-HCl, pH 8.0, 110mM NaCl, 2.2mM KCl, 80ug/ml FLAG peptide, 0.04% Tween-20, 20% glycerol.

This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.