MaxLight™650 is a new Far-IR stable dye conjugate comparable to Alexa Fluor™647, DyLight™649, Cy5™ and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (655nm); Emission (676nm); Extinction Coefficient 250,000.
Wnt-Frizzled signaling is important for early development, regulating cell fate, polarity, differentiation, and migration. The frizzled gene, originally identified in Drosophila, is involved in the development of tissue polarity. The Frizzled proteins contain seven transmembrane domains, a cysteine-rich domain in the extracellular region and a C-terminal Ser/Thr-xxx-Val motif, and they function as receptors for Wnt. Human Frizzled-2 (FZD2) is expressed in adult heart and fetal brain, lung and kidney. FZD2 activation leads to the release of beta/gamma subunit complexes from heterotrimeric G-proteins (presumably Gao and Gat) to activate phospholipase C and other effectors to stimulate a mobilization of intracellular Ca++. This does not involve the activation of the canonical WNT-beta-catenin pathway. FZD2 can also signal via the G-protein Gt2, transducin, a G-protein prominent in photo-transduction in the eye, to cyclic GMP phosphodiesterase. The calculated molecular weight of human FZD2 is ~63kD (length = 565aa) or ~71kD (length = 641aa). The observed molecular weight of ~ 85kD may be due to post-translational modifications such as glycosylation, which is predicted in the aa sequence.
Applications
Suitable for use in FLISA and Western Blot. Other applications not tested.
Recommended Dilution
Optimal dilutions to be determined by the researcher.
AA Sequence
YATLEHPFHCPRVLKVPSYLSYKFLGERDCAAPCEPARPDGSMFFSQEETRFAR
Storage and Stability
Store product at 4°C in the dark. DO NOT FREEZE! Stable at 4°C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight™650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Note: Applications are based on unconjugated antibody.