Recombinant protein corresponding to human Brain Natriuretic Peptide (BNP), a single non-glycosylated polypeptide chain containing 32aa, expressed in E. coli.
Molecular Weight
~3.5kD (32aa)
Applications
Suitable for use in SDS-PAGE. Other applications not tested.
Recommended Dilutions
Optimal dilutions to be determined by the researcher.
Amino Acid Sequence
SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O, 0.1% BSA. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder from PBS, pH 7.4. Reconstitute with sterile dH2O, 0.1% BSA to 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.