esxA; SAS0258Type VII secretion system extracellular protein A; Ess extracellular protein A
Virulence factor that is important for the establishment of infection in the host. EsxA is required for EsxB synthesis as well as secretion. Modulates host cell apoptotic pathways and mediates together with EsxB the release of S.aureus from the host cell. By acting on apoptosis, plays a role in the modulation of dendritic cell-mediated immunity.
Source
Recombinant protein corresponding to aa1-97 from Staphylococcus aureus ESAT-6 secretion system extracellular protein A, fused to 6X His-SUMO-Tag at N-terminal, expressed in E.coli.
Amino Acid Sequence
MAMIKMSPEEIRAKSQSYGQGSDQIRQILSDLTRAQGEIAANWEGQAFSRFEEQFQQLSPKVEKFAQLLEEIKQQLNSTADAVQEQDQQLSNNFGLQ
Storage and Stability
Lyophilized and reconstituted products are stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Source
Recombinant, E. coli
Form
Supplied as a lyophilized powder from 20mM Tris-HCl, 0.5M sodium chloride, pH 8.0, 6% trehalose. Reconstitute with sterile ddH2O to a concentration of 0.1-1mg/ml.
Important Note
This product as supplied is intended for research use only, not for use in human, therapeutic or diagnostic applications without the expressed written authorization of United States Biological.